PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C04686.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CPP
Protein Properties Length: 397aa    MW: 42993.1 Da    PI: 7.1637
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C04686.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.41.6e-1491128340
             TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     +k+C+CkkskClk+YC Cfa+g++C+e+C Ce C Nk 
  Pahal.C04686.1  91 CKTCSCKKSKCLKLYCVCFASGSHCTESCGCEPCLNKP 128
                     89**********************************96 PP

2TCR47.34.1e-15167202439
             TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++C+Ckks ClkkYC+C++ g+ Cs +CkCedC+N 
  Pahal.C04686.1 167 RKCTCKKSGCLKKYCDCYQGGAGCSINCKCEDCRNP 202
                     79********************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011148.8E-1089130IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163427.36290204IPR005172CRC domain
PfamPF036381.9E-1092127IPR005172CRC domain
SMARTSM011142.0E-15164205IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.5E-11167201IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MDVEEGAPKP PQPEPAGSEL DDARNTPPPP NPLPPPPAPA PAPAPVPAPA AEASAAAPHA  60
SAAISPPAAA AEANGTSDRK KKRKAEDGEG CKTCSCKKSK CLKLYCVCFA SGSHCTESCG  120
CEPCLNKPMQ GAPRTAPVLP LKPVQTLEAA QESVEQLIRS PMDLIRRKCT CKKSGCLKKY  180
CDCYQGGAGC SINCKCEDCR NPFGRKVGVI LDGKSALAAP VLNERNGAEV DSSDDEDDYY  240
MNRQLSPIPP SPVSRESSFQ QETLVGVEVQ TMNGHLYPKP LTQVRPEPPS WQLSRRPVEE  300
ARGEQWRFSR RPSEDGTSDA MEAHAMAQRD KKLEIHVDRF SIPRCIEVMS AMADLSPIEK  360
SLAPDVFLEP SNREIFLSLS VDIRPIWLRR KMKSLV*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963115.10.0PREDICTED: protein tesmin/TSO1-like CXC 7
TrEMBLK3Z6R90.0K3Z6R9_SETIT; Uncharacterized protein
STRINGSi022238m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP96102834
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-26TESMIN/TSO1-like CXC 2